Fungi AAP1 protein

Catalog Number: BYT-ORB358151
Article Name: Fungi AAP1 protein
Biozol Catalog Number: BYT-ORB358151
Supplier Catalog Number: orb358151
Alternative Catalog Number: BYT-ORB358151-20,BYT-ORB358151-100,BYT-ORB358151-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: AAP1, YHR047CAlanine/arginine aminopeptidase, EC 3.4.11.-
This Fungi AAP1 protein spans the amino acid sequence from region 1-389aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.8 kDa
UniProt: P37898
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDM
Application Notes: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: Partial of His-SUMO-tag and expression region is 1-389aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.