Birds pKIWI502 protein

Catalog Number: BYT-ORB358158
Article Name: Birds pKIWI502 protein
Biozol Catalog Number: BYT-ORB358158
Supplier Catalog Number: orb358158
Alternative Catalog Number: BYT-ORB358158-20,BYT-ORB358158-100,BYT-ORB358158-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: pKIWI502, Fruit protein pKIWI502
This Birds pKIWI502 protein spans the amino acid sequence from region 1-317aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.2 kDa
UniProt: P43394
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Actinidia deliciosa (Kiwi)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSITLSRPSLSRPSLSRHPSLTLHSSLSHAPPHHRPVAFLRHPTLRYHHHGRLLSVASAILQDTAIRQDTYIWTPVPISRVLPAAAESLFKVIVDLSRSPDLVYNFVSPGQYVQIRIPEAIVNPPPRPAYFYIASPPSLVKKNLEFEFLIRSVPGTTSEVLCSLKEGDVVDLTQIIGRGFDIEQILPPEDYPTVLISVTGYGMSAGRSFIEEGFGANKRSDVRLYYGAENLETMGYQERFKDWEASGVRVIPVLS
Application Notes: Biological Origin: Actinidia deliciosa (Kiwi). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.