E. coli uspF protein

Catalog Number: BYT-ORB358160
Article Name: E. coli uspF protein
Biozol Catalog Number: BYT-ORB358160
Supplier Catalog Number: orb358160
Alternative Catalog Number: BYT-ORB358160-20,BYT-ORB358160-100,BYT-ORB358160-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: uspF, ynaF, yzzL, b1376, JW1370Universal stress protein F
This E. coli uspF protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 32 kDa
UniProt: P37903
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.