Bacterial fkpA protein
Catalog Number:
BYT-ORB358181
- Images (3)
| Article Name: | Bacterial fkpA protein |
| Biozol Catalog Number: | BYT-ORB358181 |
| Supplier Catalog Number: | orb358181 |
| Alternative Catalog Number: | BYT-ORB358181-20,BYT-ORB358181-100,BYT-ORB358181-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Rotamase |
| This Bacterial fkpA protein spans the amino acid sequence from region 21-268aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 42.7 kDa |
| UniProt: | O08437 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Aeromonas hydrophila |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CQKDEKTAANTAEVKAEASKPAEAPKAEAKSFEEQSGYAIGLSMGRYIANTLERQQELGIKLDNSVILKGVTDGLGKEAKMTDEEIQKVLQQYDAKINELTKAKADKDAVENQKKGEEYLAANAKKEGVKSTESGLQYQVEKMGTGAKPKATDIVKVHYTGTLTDGTKFDSSVDRGEPATFPLNQVIPGWTEGVQLMPVGSKFKFFLPSKLAYGEHGAGSIPANAVLVFDVELLAIEKPAADGDNAKK |
| Application Notes: | Biological Origin: Aeromonas hydrophila. Application Notes: This is His-SUMO-tag protein |



