parasite Plasmepsin-1 protein
Catalog Number:
BYT-ORB358199
- Images (3)
| Article Name: | parasite Plasmepsin-1 protein |
| Biozol Catalog Number: | BYT-ORB358199 |
| Supplier Catalog Number: | orb358199 |
| Alternative Catalog Number: | BYT-ORB358199-20,BYT-ORB358199-100,BYT-ORB358199-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Aspartic hemoglobinase IPfAPG |
| This parasite Plasmepsin-1 protein spans the amino acid sequence from region 125-452aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 52.9 kDa |
| UniProt: | Q7KQM4 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Plasmodium falciparum (isolate 3D7) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPT |
| Application Notes: | Biological Origin: Plasmodium falciparum (isolate 3D7). Application Notes: This is His-SUMO-tag protein |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Plasmodium falciparum (isolate 3D7) PF14_0076. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Plasmodium falciparum (isolate 3D7) PF14_0076. |
Product Guarantee and Expert Support
