Rat Dac g 3 protein

Catalog Number: BYT-ORB358270
Article Name: Rat Dac g 3 protein
Biozol Catalog Number: BYT-ORB358270
Supplier Catalog Number: orb358270
Alternative Catalog Number: BYT-ORB358270-1,BYT-ORB358270-100,BYT-ORB358270-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Dac g III Allergen, Dac g 3
This Rat Dac g 3 protein spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 12.9 kDa
UniProt: P93124
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Dactylis glomerata (Orchard grass) (Cocks-foot grass)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
Application Notes: Biological Origin: Dactylis glomerata (Orchard grass) (Cocks-foot grass). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.