E. coli fkpA protein

Catalog Number: BYT-ORB358282
Article Name: E. coli fkpA protein
Biozol Catalog Number: BYT-ORB358282
Supplier Catalog Number: orb358282
Alternative Catalog Number: BYT-ORB358282-1,BYT-ORB358282-100,BYT-ORB358282-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Rotamase
This E. coli fkpA protein spans the amino acid sequence from region 26-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.3 kDa
UniProt: P65764
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AEAAKPATTADSKAAFKNDDQKSAYALGASLGRYMENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQAFEARVKSSAQAKMEKDAADNEAKGKEYREKFAKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTLVFDVELLDVKPAPKADAKPEADAKAADSAKK
Application Notes: Biological Origin: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.