Plant Ribosome-inactivating protein alpha-trichosanthin protein

Catalog Number: BYT-ORB358285
Article Name: Plant Ribosome-inactivating protein alpha-trichosanthin protein
Biozol Catalog Number: BYT-ORB358285
Supplier Catalog Number: orb358285
Alternative Catalog Number: BYT-ORB358285-1,BYT-ORB358285-100,BYT-ORB358285-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: rRNA N-glycosidase
This Plant Ribosome-inactivating protein alpha-trichosanthin protein spans the amino acid sequence from region 24-270aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.1 kDa
UniProt: P09989
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Application Notes: Biological Origin: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.