Mouse Scrg1 protein

Catalog Number: BYT-ORB358289
Article Name: Mouse Scrg1 protein
Biozol Catalog Number: BYT-ORB358289
Supplier Catalog Number: orb358289
Alternative Catalog Number: BYT-ORB358289-1,BYT-ORB358289-100,BYT-ORB358289-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Scrapie-responsive gene 1 protein , ScRG-1
This Mouse Scrg1 protein spans the amino acid sequence from region 21-98aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 11 kDa
UniProt: O88745
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.