Human GCKR protein

Catalog Number: BYT-ORB358296
Article Name: Human GCKR protein
Biozol Catalog Number: BYT-ORB358296
Supplier Catalog Number: orb358296
Alternative Catalog Number: BYT-ORB358296-1,BYT-ORB358296-100,BYT-ORB358296-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FGQTL5, GCK, GCKR, GCKR_HUMAN, GKRP , GLRE, glucokinase (hexokinase 4) regulator, Glucokinase, Glucokinase regulator, Glucokinase regulatory protein, Hexokinase 4 regulator, Hexokinase type IV, Hexokinase-4, Hexokinase-D, HK IV, HK4, OTTHUMP00000158533
This Human GCKR protein spans the amino acid sequence from region 1-625aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 70.7 kDa
UniProt: Q14397
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPGTKRFQHVIETPEPGKWELSGYEAAVPITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALSTYQRLYSESILTTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKMQEKQKAFVLNPAIGPEGLS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.