Viral GP protein

Catalog Number: BYT-ORB358299
Article Name: Viral GP protein
Biozol Catalog Number: BYT-ORB358299
Supplier Catalog Number: orb358299
Alternative Catalog Number: BYT-ORB358299-1,BYT-ORB358299-100,BYT-ORB358299-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GP1,2 , GP
This Viral GP protein spans the amino acid sequence from region 502-637aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 17.4 kDa
UniProt: Q7T9D9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
Application Notes: Biological Origin: Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.