Mouse Ly6e protein

Catalog Number: BYT-ORB358320
Article Name: Mouse Ly6e protein
Biozol Catalog Number: BYT-ORB358320
Supplier Catalog Number: orb358320
Alternative Catalog Number: BYT-ORB358320-1,BYT-ORB358320-100,BYT-ORB358320-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Stem cell antigen 2 Thymic shared antigen 1 Short name, TSA-1
This Mouse Ly6e protein spans the amino acid sequence from region 21-102aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.8 kDa
UniProt: Q64253
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.