Fungi GSP1 protein

Catalog Number: BYT-ORB358324
Article Name: Fungi GSP1 protein
Biozol Catalog Number: BYT-ORB358324
Supplier Catalog Number: orb358324
Alternative Catalog Number: BYT-ORB358324-1,BYT-ORB358324-100,BYT-ORB358324-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Chromosome stability protein 17 GTPase Ran homolog Genetic suppressor of PRP20-1
This Fungi GSP1 protein spans the amino acid sequence from region 2-219aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.7 kDa
UniProt: P32835
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
Application Notes: Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.