Bacterial ssaA1 protein

Catalog Number: BYT-ORB358338
Article Name: Bacterial ssaA1 protein
Biozol Catalog Number: BYT-ORB358338
Supplier Catalog Number: orb358338
Alternative Catalog Number: BYT-ORB358338-1,BYT-ORB358338-100,BYT-ORB358338-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ssaA1, SACOL2581, Staphylococcal secretory antigen ssaA1
This Bacterial ssaA1 protein spans the amino acid sequence from region 27-255aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27 kDa
UniProt: Q5HCY4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus (strain COL)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTGNWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGASYSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTSRTISANQAGSYNFIH
Application Notes: Biological Origin: Staphylococcus aureus (strain COL). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.