Mouse Hspa1b protein

Catalog Number: BYT-ORB358342
Article Name: Mouse Hspa1b protein
Biozol Catalog Number: BYT-ORB358342
Supplier Catalog Number: orb358342
Alternative Catalog Number: BYT-ORB358342-1,BYT-ORB358342-100,BYT-ORB358342-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Heat shock 70KDA protein 1 Short name, HSP70.1
This Mouse Hspa1b protein spans the amino acid sequence from region 2-642aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 86 kDa
UniProt: P17879
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVNYKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQN
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.