Plant EPB2 protein

Catalog Number: BYT-ORB358358
Article Name: Plant EPB2 protein
Biozol Catalog Number: BYT-ORB358358
Supplier Catalog Number: orb358358
Alternative Catalog Number: BYT-ORB358358-1,BYT-ORB358358-100,BYT-ORB358358-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: EPB2, Cysteine proteinase EP-B 2, EC 3.4.22.-
This Plant EPB2 protein spans the amino acid sequence from region 134-373aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 41.3 kDa
UniProt: P25250
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Hordeum vulgare (Barley)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPPSVDWRQKGAVTGVKDQGKCGSCWAFSTVVSVEGINAIRTGSLVSLSEQELIDCDTADNDGCQGGLMDNAFEYIKNNGGLITEAAYPYRAARGTCNVARAAQNSPVVVHIDGHQDVPANSEEDLARAVANQPVSVAVEASGKAFMFYSEGVFTGECGTELDHGVAVVGYGVAEDGKAYWTVKNSWGPSWGEQGYIRVEKDSGASGGLCGIAMEASYPVKTYSKPKPTPRRALGARESL
Application Notes: Biological Origin: Hordeum vulgare (Barley). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.