Mouse Tnfrsf4 protein

Catalog Number: BYT-ORB358365
Article Name: Mouse Tnfrsf4 protein
Biozol Catalog Number: BYT-ORB358365
Supplier Catalog Number: orb358365
Alternative Catalog Number: BYT-ORB358365-1,BYT-ORB358365-100,BYT-ORB358365-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: OX40 antigen OX40L receptor CD_antigen, CD134
This Mouse Tnfrsf4 protein spans the amino acid sequence from region 20-211aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 37.3 kDa
UniProt: P47741
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.