Bacterial Levanase protein

Catalog Number: BYT-ORB358369
Article Name: Bacterial Levanase protein
Biozol Catalog Number: BYT-ORB358369
Supplier Catalog Number: orb358369
Alternative Catalog Number: BYT-ORB358369-1,BYT-ORB358369-100,BYT-ORB358369-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: 2,6-beta-D-fructan fructanohydrolase Endo-levanase
This Bacterial Levanase protein spans the amino acid sequence from region 451-579aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.3 kDa
UniProt: O31411
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bacillus sp. (strain L7)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF
Application Notes: Biological Origin: Bacillus sp. (strain L7). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.