Bacterial TST protein

Catalog Number: BYT-ORB358370
Article Name: Bacterial TST protein
Biozol Catalog Number: BYT-ORB358370
Supplier Catalog Number: orb358370
Alternative Catalog Number: BYT-ORB358370-1,BYT-ORB358370-100,BYT-ORB358370-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: TSST-1
This Bacterial TST protein spans the amino acid sequence from region 41-234aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 37.9 kDa
UniProt: P06886
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN
Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.