Reptile Cytotoxin 4 protein

Catalog Number: BYT-ORB358371
Article Name: Reptile Cytotoxin 4 protein
Biozol Catalog Number: BYT-ORB358371
Supplier Catalog Number: orb358371
Alternative Catalog Number: BYT-ORB358371-1,BYT-ORB358371-100,BYT-ORB358371-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cardiotoxin A4 Short name, CTX A4 Cardiotoxin analog IV Short name, CTX IV
This Reptile Cytotoxin 4 protein spans the amino acid sequence from region 22-81aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.8 kDa
UniProt: P01443
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Naja atra (Chinese cobra)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Application Notes: Biological Origin: Naja atra (Chinese cobra). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.