Bacterial bla protein

Catalog Number: BYT-ORB358391
Article Name: Bacterial bla protein
Biozol Catalog Number: BYT-ORB358391
Supplier Catalog Number: orb358391
Alternative Catalog Number: BYT-ORB358391-1,BYT-ORB358391-100,BYT-ORB358391-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Carbapenem-hydrolyzing beta-lactamase KPC-2
This Bacterial bla protein spans the amino acid sequence from region 25-293aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.5 kDa
UniProt: Q848S6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Klebsiella oxytoca
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAA
Application Notes: Biological Origin: Klebsiella oxytoca. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.