Horse Major allergen Equ c 1 protein

Catalog Number: BYT-ORB358427
Article Name: Horse Major allergen Equ c 1 protein
Biozol Catalog Number: BYT-ORB358427
Supplier Catalog Number: orb358427
Alternative Catalog Number: BYT-ORB358427-20,BYT-ORB358427-100,BYT-ORB358427-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen, Equ c 1
This Horse Major allergen Equ c 1 protein spans the amino acid sequence from region 16-187aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.1 kDa
UniProt: Q95182
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Equus caballus (Horse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA
Application Notes: Biological Origin: Equus caballus (Horse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.