Mouse Mapt protein

Catalog Number: BYT-ORB358485
Article Name: Mouse Mapt protein
Biozol Catalog Number: BYT-ORB358485
Supplier Catalog Number: orb358485
Alternative Catalog Number: BYT-ORB358485-20,BYT-ORB358485-100,BYT-ORB358485-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Neurofibrillary tangle protein Paired helical filament-tau Short name, PHF-tau
This Mouse Mapt protein spans the amino acid sequence from region 2-733aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 78.1 kDa
UniProt: P10637
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKESPPQPPADDGAEEPGSETSDAKSTPTAEDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGIGDTPNQEDQAAGHVTQGRREGQAPDLGTSDWTRQQVSSMSGAPLLPQGLREATCQPSGTRPEDIEKSHPASELLRRGPPQKEGWGQDRLGSEEEVDEDLTVDESSQDSPPSQASLTPGRAAPQAGSGSVCGETASVPGLPTEGSVPLPADFFSKVSAET
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mapt.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Mapt.