Dog Major allergen Can f 1 protein

Catalog Number: BYT-ORB358538
Article Name: Dog Major allergen Can f 1 protein
Biozol Catalog Number: BYT-ORB358538
Supplier Catalog Number: orb358538
Alternative Catalog Number: BYT-ORB358538-20,BYT-ORB358538-100,BYT-ORB358538-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Dog 1 Allergen, Can f 1
This Dog Major allergen Can f 1 protein spans the amino acid sequence from region 19-174aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 33.3 kDa
UniProt: O18873
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Canis lupus familiaris (Dog) (Canis familiaris)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ
Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris).