Bacterial pac protein

Catalog Number: BYT-ORB358568
Article Name: Bacterial pac protein
Biozol Catalog Number: BYT-ORB358568
Supplier Catalog Number: orb358568
Alternative Catalog Number: BYT-ORB358568-20,BYT-ORB358568-100,BYT-ORB358568-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: pac, Puromycin N-acetyltransferase, EC 2.3.-.-
This Bacterial pac protein spans the amino acid sequence from region 1-199aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 37.5 kDa
UniProt: P13249
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptomyces alboniger
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA
Application Notes: Biological Origin: Streptomyces alboniger. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptomyces albonigerpac.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Streptomyces albonigerpac.