Human DNASE1L3 protein

Catalog Number: BYT-ORB358592
Article Name: Human DNASE1L3 protein
Biozol Catalog Number: BYT-ORB358592
Supplier Catalog Number: orb358592
Alternative Catalog Number: BYT-ORB358592-20,BYT-ORB358592-100,BYT-ORB358592-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DNase I homolog protein DHP2 Deoxyribonuclease I-like 3 Short name, DNase I-like 3 Liver and spleen DNase Short name, LS-DNase Short name, LSD
This Human DNASE1L3 protein spans the amino acid sequence from region 21-305aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.4 kDa
UniProt: Q13609
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is GST-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DNASE1L3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DNASE1L3.