Fungi CDH-1 protein

Catalog Number: BYT-ORB358757
Article Name: Fungi CDH-1 protein
Biozol Catalog Number: BYT-ORB358757
Supplier Catalog Number: orb358757
Alternative Catalog Number: BYT-ORB358757-20,BYT-ORB358757-100,BYT-ORB358757-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cellobiose-quinone oxidoreductase
This Fungi CDH-1 protein spans the amino acid sequence from region 19-208aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.3 kDa
UniProt: Q01738
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Application Notes: Biological Origin: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) CDH-1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) CDH-1.