Bacterial btfP protein

Catalog Number: BYT-ORB358770
Article Name: Bacterial btfP protein
Biozol Catalog Number: BYT-ORB358770
Supplier Catalog Number: orb358770
Alternative Catalog Number: BYT-ORB358770-20,BYT-ORB358770-100,BYT-ORB358770-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Enterotoxin
This Bacterial btfP protein spans the amino acid sequence from region 26-405aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.6 kDa
UniProt: P54355
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bacteroides fragilis
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCP
Application Notes: Biological Origin: Bacteroides fragilis. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacteroides fragilisbtfP.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bacteroides fragilisbtfP.