Human ZG16B protein

Catalog Number: BYT-ORB358798
Article Name: Human ZG16B protein
Biozol Catalog Number: BYT-ORB358798
Supplier Catalog Number: orb358798
Alternative Catalog Number: BYT-ORB358798-20,BYT-ORB358798-100,BYT-ORB358798-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ZG16B, UNQ773/PRO1567Zymogen granule protein 16 homolog B
This Human ZG16B protein spans the amino acid sequence from region 53-208aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.2 kDa
UniProt: Q96DA0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ZG16B.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) ZG16B.