Human KCNA1 protein

Catalog Number: BYT-ORB382955
Article Name: Human KCNA1 protein
Biozol Catalog Number: BYT-ORB382955
Supplier Catalog Number: orb382955
Alternative Catalog Number: BYT-ORB382955-20,BYT-ORB382955-100,BYT-ORB382955-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Voltage-gated K(+) channel HuKI1
This Human KCNA1 protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.2 kDa
UniProt: Q09470
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVW
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.