Human MKI67 protein

Catalog Number: BYT-ORB382959
Article Name: Human MKI67 protein
Biozol Catalog Number: BYT-ORB382959
Supplier Catalog Number: orb382959
Alternative Catalog Number: BYT-ORB382959-20,BYT-ORB382959-100,BYT-ORB382959-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Antigen identified by monoclonal Ki 67 , Antigen identified by monoclonal Ki-67, Antigen KI-67, Antigen KI67 , Antigen Ki67, KI67_HUMAN, KIA, Marker of proliferation Ki-67, MIB 1, MIB, MKI67, PPP1R105, Proliferation marker protein Ki-67, Proliferation related Ki 67 antigen , Protein phosphatase 1 regulatory subunit 105, RP11-380J17.2
This Human MKI67 protein spans the amino acid sequence from region 2891-3256aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.6 kDa
UniProt: P46013
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAADSFTSAPKQTPDSGKPLKISRRVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRGGGKDGSVTGTKRLRCMPAPEEIVEELPASKKQRVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEELNSNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTEAEQQITEVFVLAERIEINRNEKKPMKTSPEMDIQNPDDGARKPIP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.