Human MMP14 protein

Catalog Number: BYT-ORB382962
Article Name: Human MMP14 protein
Biozol Catalog Number: BYT-ORB382962
Supplier Catalog Number: orb382962
Alternative Catalog Number: BYT-ORB382962-20,BYT-ORB382962-100,BYT-ORB382962-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MMP-X1Membrane-type matrix metalloproteinase 1 , MT-MMP 1 , MTMMP1Membrane-type-1 matrix metalloproteinase , MT1-MMP , MT1MMP
This Human MMP14 protein spans the amino acid sequence from region 112-582aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 69.9 kDa
UniProt: P50281
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP14.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) MMP14.