Human MMP3 protein

Catalog Number: BYT-ORB382963
Article Name: Human MMP3 protein
Biozol Catalog Number: BYT-ORB382963
Supplier Catalog Number: orb382963
Alternative Catalog Number: BYT-ORB382963-20,BYT-ORB382963-100,BYT-ORB382963-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Matrix metalloproteinase-3 , MMP-3Transin-1
This Human MMP3 protein spans the amino acid sequence from region 102-477aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.5 kDa
UniProt: P08254
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.