Human NKRF protein

Catalog Number: BYT-ORB382964
Article Name: Human NKRF protein
Biozol Catalog Number: BYT-ORB382964
Supplier Catalog Number: orb382964
Alternative Catalog Number: BYT-ORB382964-20,BYT-ORB382964-100,BYT-ORB382964-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein ITBA4Transcription factor NRF
This Human NKRF protein spans the amino acid sequence from region 4-688aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 81.1 kDa
UniProt: O15226
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQEDPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQDGNSQYCDSSGFILTKDQPVTANMYFDSGNPAPSTTSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.