Bovine SEPP1 protein

Catalog Number: BYT-ORB382970
Article Name: Bovine SEPP1 protein
Biozol Catalog Number: BYT-ORB382970
Supplier Catalog Number: orb382970
Alternative Catalog Number: BYT-ORB382970-20,BYT-ORB382970-100,BYT-ORB382970-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Selenoprotein P-like protein
This Bovine SEPP1 protein spans the amino acid sequence from region 20-402aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 70.1 kDa
UniProt: P49907
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASSYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGH
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: E.coli and Yeast N-terminal GST-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.