Pig VEGF protein

Catalog Number: BYT-ORB382973
Article Name: Pig VEGF protein
Biozol Catalog Number: BYT-ORB382973
Supplier Catalog Number: orb382973
Alternative Catalog Number: BYT-ORB382973-20,BYT-ORB382973-100,BYT-ORB382973-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Vascular permeability factor , VPF
This Pig VEGF protein spans the amino acid sequence from region 27-190aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 23.2 kDa
UniProt: P49151
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.