Bacterial cpg2 protein

Catalog Number: BYT-ORB382981
Article Name: Bacterial cpg2 protein
Biozol Catalog Number: BYT-ORB382981
Supplier Catalog Number: orb382981
Alternative Catalog Number: BYT-ORB382981-20,BYT-ORB382981-100,BYT-ORB382981-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Folate hydrolase G2Glutamate carboxypeptidasePteroylmonoglutamic acid hydrolase G2INN, Glucarpidase
This Bacterial cpg2 protein spans the amino acid sequence from region 23-415aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 68.7 kDa
UniProt: P06621
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Pseudomonas sp. (strain RS-16)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNII
Application Notes: Biological Origin: Pseudomonas sp. (strain RS-16). Application Notes: E.coli and Yeast N-terminal GST-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.