Human TFF1 protein

Catalog Number: BYT-ORB383006
Article Name: Human TFF1 protein
Biozol Catalog Number: BYT-ORB383006
Supplier Catalog Number: orb383006
Alternative Catalog Number: BYT-ORB383006-20,BYT-ORB383006-100,BYT-ORB383006-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Breast cancer estrogen-inducible protein, PNR-2, Polypeptide P1.A , hP1.AProtein pS2
This Human TFF1 protein spans the amino acid sequence from region 25-84aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 8.7 kDa
UniProt: P04155
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.