Bacterial ureA protein

Catalog Number: BYT-ORB383012
Article Name: Bacterial ureA protein
Biozol Catalog Number: BYT-ORB383012
Supplier Catalog Number: orb383012
Alternative Catalog Number: BYT-ORB383012-20,BYT-ORB383012-100,BYT-ORB383012-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Urea amidohydrolase subunit alpha
This Bacterial ureA protein spans the amino acid sequence from region 1-238aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.5 kDa
UniProt: P14916
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
Application Notes: Biological Origin: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.