Human F11 protein

Catalog Number: BYT-ORB383030
Article Name: Human F11 protein
Biozol Catalog Number: BYT-ORB383030
Supplier Catalog Number: orb383030
Alternative Catalog Number: BYT-ORB383030-20,BYT-ORB383030-100,BYT-ORB383030-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Plasma thromboplastin antecedent Short name, PTA Cleaved into the following 2 chains, Coagulation factor XIa heavy chain Coagulation factor XIa light chain
This Human F11 protein spans the amino acid sequence from region 19-387aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45.2 kDa
UniProt: P03951
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.