Pig F12 protein

Catalog Number: BYT-ORB383031
Article Name: Pig F12 protein
Biozol Catalog Number: BYT-ORB383031
Supplier Catalog Number: orb383031
Alternative Catalog Number: BYT-ORB383031-20,BYT-ORB383031-100,BYT-ORB383031-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Hageman factor Short name, HAF
This Pig F12 protein spans the amino acid sequence from region 20-371aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.8 kDa
UniProt: O97507
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTR
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.