Bacterial map protein

Catalog Number: BYT-ORB383036
Article Name: Bacterial map protein
Biozol Catalog Number: BYT-ORB383036
Supplier Catalog Number: orb383036
Alternative Catalog Number: BYT-ORB383036-20,BYT-ORB383036-100,BYT-ORB383036-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Short name, MAPUniRule annotation Short name, MetAPUniRule annotation Alternative name(s), Peptidase M
This Bacterial map protein spans the amino acid sequence from region 1-248aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.7 kDa
UniProt: Q11132
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVYLKSAREVEQIRQACKIFQEAKAYFTIERLLGKSLTAIDQALKQFIESKGATCAFHKYQNFPGFNCLSLNETVIHGIADNRVFGVKDKLTLDIGINLNGYICDAAFTVLGPKAPEPMQTLLEVTEACFTAVVEPQLRPNNPTGNVSHAIQTYFESKGYYLLKQFGGHGCGIKVHEEPLILNYGKPDTGTKLEPGMVLCIEPMVMTDSDAMVMHNNSWNVLTPKSRYNCHVEQMYVITTSGFECLTN
Application Notes: Biological Origin: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.