Mouse Rorc protein

Catalog Number: BYT-ORB383038
Article Name: Mouse Rorc protein
Biozol Catalog Number: BYT-ORB383038
Supplier Catalog Number: orb383038
Alternative Catalog Number: BYT-ORB383038-20,BYT-ORB383038-100,BYT-ORB383038-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 RAR-related orphan receptor C Retinoid-related orphan receptor-gamma Thymus orphan receptor Short name, TOR
This Mouse Rorc protein spans the amino acid sequence from region 1-516aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.1 kDa
UniProt: P51450
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFC
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.