Human DCP1A protein

Catalog Number: BYT-ORB383048
Article Name: Human DCP1A protein
Biozol Catalog Number: BYT-ORB383048
Supplier Catalog Number: orb383048
Alternative Catalog Number: BYT-ORB383048-20,BYT-ORB383048-100,BYT-ORB383048-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Smad4-interacting transcriptional co-activator Transcription factor SMIF
This Human DCP1A protein spans the amino acid sequence from region 1-582aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 67.3 kDa
UniProt: Q9NPI6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.