Plant RUBISCO protein

Catalog Number: BYT-ORB383054
Article Name: Plant RUBISCO protein
Biozol Catalog Number: BYT-ORB383054
Supplier Catalog Number: orb383054
Alternative Catalog Number: BYT-ORB383054-20,BYT-ORB383054-100,BYT-ORB383054-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: anti 3 phospho D glycerate carboxylaseprotein, anti rbcLprotein, anti Ribulose bisphosphate carboxylase large chainprotein, anti RuBisCO large subunitprotein, anti Ribulose bisphosphate carboxylase oxygenaseprotein, anti Ribulose-1,5-bisphosphate carboxylase oxygenaseprotein
This Plant RUBISCO protein spans the amino acid sequence from region 3-475aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 68.4 kDa
UniProt: P27066
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Glycine max (Soybean) (Glycine hispida)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAVFA
Application Notes: Biological Origin: Glycine max (Soybean) (Glycine hispida). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.