Reptile subunit alpha protein

Catalog Number: BYT-ORB383058
Article Name: Reptile subunit alpha protein
Biozol Catalog Number: BYT-ORB383058
Supplier Catalog Number: orb383058
Alternative Catalog Number: BYT-ORB383058-20,BYT-ORB383058-100,BYT-ORB383058-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Aggretin alpha chain Rhodoaggretin subunit alpha
This Reptile subunit alpha protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.8 kDa
UniProt: Q9I841
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY
Application Notes: Biological Origin: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.