Human TRPA1 protein

Catalog Number: BYT-ORB383059
Article Name: Human TRPA1 protein
Biozol Catalog Number: BYT-ORB383059
Supplier Catalog Number: orb383059
Alternative Catalog Number: BYT-ORB383059-20,BYT-ORB383059-100,BYT-ORB383059-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120
This Human TRPA1 protein spans the amino acid sequence from region 957-1119aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 35.2 kDa
UniProt: O75762
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.