Mouse Ube3a protein

Catalog Number: BYT-ORB383064
Article Name: Mouse Ube3a protein
Biozol Catalog Number: BYT-ORB383064
Supplier Catalog Number: orb383064
Alternative Catalog Number: BYT-ORB383064-20,BYT-ORB383064-100,BYT-ORB383064-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Oncogenic protein-associated protein E6-AP
This Mouse Ube3a protein spans the amino acid sequence from region 542-870aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 39.9 kDa
UniProt: O08759
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQ
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.