Chicken RHOT1 protein

Catalog Number: BYT-ORB383070
Article Name: Chicken RHOT1 protein
Biozol Catalog Number: BYT-ORB383070
Supplier Catalog Number: orb383070
Alternative Catalog Number: BYT-ORB383070-20,BYT-ORB383070-100,BYT-ORB383070-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MIRO-1 Alternative name(s), Ras homolog gene family member T1
This Chicken RHOT1 protein spans the amino acid sequence from region 1-219aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 41 kDa
UniProt: Q5ZM73
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Gallus gallus (Chicken)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT
Application Notes: Biological Origin: Gallus gallus (Chicken). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.