Bacterial ssaA2 protein

Catalog Number: BYT-ORB383071
Article Name: Bacterial ssaA2 protein
Biozol Catalog Number: BYT-ORB383071
Supplier Catalog Number: orb383071
Alternative Catalog Number: BYT-ORB383071-20,BYT-ORB383071-100,BYT-ORB383071-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ssaA2, SAV2299, Staphylococcal secretory antigen ssaA2
This Bacterial ssaA2 protein spans the amino acid sequence from region 28-267aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 42.7 kDa
UniProt: Q99RX4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus (strain Mu50 / ATCC 700699)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH
Application Notes: Biological Origin: Staphylococcus aureus (strain Mu50 / ATCC 700699). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.